- C18orf21 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP2-49514
- 0.1 ml (also 25ul)
- Immunohistochemistry, Immunohistochemistry-Paraffin
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Human
- C18orf21
- IgG
- Rabbit
- This antibody was developed against a recombinant protein corresponding to amino acids: TCNRTVKHHG KSRSFVSTLK SNPATPTSKL SLKTPERRTA NPNHDMSGSK G
- chromosome 18 open reading frame 21
- HsT3108, PNAS-124, PNAS-131, XTP13
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
TCNRTVKHHGKSRSFVSTLKSNPATPTSKLSLKTPERRTANPNHDMSGSKG
Specifications/Features
Available conjugates: Unconjugated